Xampp download for windows 79/17/2023 ![]() ![]() XAMPP is a great tool for developers and database managers because it offers them all the tools they’ll need to perform their tasks easily. You can run the XAMPP control panel to run the service you want and get started quickly. XAMPP 7.0.0 for Windows Requirements: Windows 8.1, Windows 8, Windows 10, Windows 7 Language: English Available languages: English, German, Spanish, French, Italian, Japanese, Polish, Chinese, Polish, Portuguese, Russian, Turkish, Chinese License: Free Latest update: Thursday, October 27th 2022 Author: Apache Friends. You’ll be able to decide which components you’ll install, which means that if you only need one component, you can disregard the other parts of the app.Īll the services will be stopped when you launch the app, so you’ll only have to start the ones you need manually. ![]() Decide Which Components You’ll InstallĪdditionally, XAMPP gives you the freedom of choice when installing it on your computer. See: Features, Requirements, Skins, References. It’s intuitive and easy to use for experienced users. SQLite, MS SQL, Oracle, Elasticsearch, MongoDB and others via plugin. It’s also useful for checking out dynamic web pages without connecting to the Internet. You can download XAMPP 32-bit architecture for the Microsoft Windows operating system like Windows XP, Windows Vista, Windows 7, Windows 8, Windows 8.1, and Windows 10 from the official XAMPP repository ( /projects/xampp) or from the Isrg KB official XAMPP archive. You can do that by using PHP, and it offers you everything you’d need to create a web server that’s reliable and fast. Then, you’ll be able to create and set up your server. Historical releases, including the 1.3, 2.0 and 2.2 families of releases, are available from the archive download site. Moreover, you can use the FileZilla FTP server to control your CMS libraries. It is great when you want to manage large CMS libraries and also databases. Info Downloads / Week Parent folder xampp-portable-windows-圆4-7.2.30-0-VC15.7z: : 77.9 MB: 4. For instance, you’ll be able to manage your MySQL and SQLite databases with this tool. With it, you’ll be able to manage and perform various developer tasks. It’s also useful for testing dynamic pages and ensuring you can do that without access to the Internet. It helps them create servers and other things with Apache, as it offers some of the best distributions like MySQL, PHP, Perl, and others. Also Available: Download XAMPP for Mac and XAMPP Portable. Always available from the Softonic servers Free & fast download Always available Tested virus-free Free Download for PC Alternative XAMPP download from external server (availability not guaranteed) Alternatives to XAMPP 3. ES Easy to install Apache distribution containing MySQL, PHP and Perl. Free In English V 8.1.10 3.6 (2408) Security Status XAMPP free download. 100 Safe and Secure Free Download (32-bit/64-bit) Software Version. It is a well-known application for developers. Download XAMPP 7.4.27 for Windows PC from FileHorse. XAMPP is the Apache distribution for Windows containing MySQL, PHP, and Perl, enabling you to intuitively create and configure your server. ![]()
0 Comments
Marco antonio solis concert 2022 usa9/17/2023 ![]() ![]() The album “Gracias por Estar Aquí” appeared in April 2014, laden with Latin Grammy nominations for Best Traditional Pop Vocal Album and Best Regional Song for “De Mil Amores”. Browse 2023 tour dates, venue details, concert reviews, photos, and more at. All albums of which topped the Billboard Latin Albums charts, and after a modest break from recording and touring, Solís was back to release his tenth consecutive Latin Album Chart No. Find tickets for Marco Antonio Solis concerts near you. 2” in 2006, the live album “Noche en Madrid” in 2008, and his eighth studio album “No Molestar” also in 2008. Marco Antonio Solss Community, tickets, shows, tour 2023-2024. Solís subsequently released the second part to “La Historia Continúa…” in 2005, the Grammy-nominated “Trozos de Mi Alma, Vol. If you are a true fan of Marco Antonio Sols, you will want to find out before anyone. As the new millennium stretched out, the singer released a series of well-received albums including 2003’s “Tu Amor o Tu Desprecio”, the best-of “La Historia Continúa…”, the split release with Joan Sebastían “Dos Grandes”, and 2004’s “Razon de Sobra”. Get the Marco Antonio Solís Setlist of the concert at BOK Center, Tulsa, OK, USA on Apfrom the Qué ganas de verte World Tour and other Marco Antonio Solís Setlists for free on setlist. In 2001 the reflective and sentimental “Mas de Mi Alma” was issued by Solís and once again became a best-seller supported by the singles “Cuando Te Acuerdes de Mi” and “Si No Te Hubieras Ido”. ![]() After contributing lyrics and production to popular singers including Marisela and Rocíoa Dúrcal, and following 20 years of Los Bukis, in 1975 Solís decided to pursue a solo career.īy 1999 Solís had released four platinum-selling albums “Quiereme”, “Inalcanzable”, “Por Amor a Mi Pueblo”, and “Trozos de Mi Alma”, and had solidified his reputation as a revered Latin American artist. Marco Antonio Solis Concert Details Date: Saturday, Venue: Allstate Arena Location: Rosemont, Illinois, United States Band Genres Ballad, Cumbia, Latin, Latin Pop, Ranchera, Spanish, Tropical, Musica Mexicana, Romantica, Grupera, and Romantico. In the subsequent 20 years, Los Bukis would prove to be one of the most influential Mexican bands on tejano and norteño music, releasing 16 studio albums and countless hit singles. By the early ’70s Los Hermanitos Solís disbanded and the young singer-songwriter formed Los Bukis and began playing traditional Mexican music in the styles of tejano and norteño. Wasting little time in his pursuit for music, Solís formed his first group, Los Hermanitos Solís, alongside brother Joel aged 12. ![]() Software to align dna sequences9/17/2023 ![]() ![]() This will help us understand the concept of sequence alignment and how to program it using Biopython. Let us write an example to find the sequence alignment of two simple and hypothetical sequences using pairwise module. Biopython applies the best algorithm to find the alignment sequence and it is par with other software. Pairwise is easy to understand and exceptional to infer from the resulting sequence alignment.īiopython provides a special module, Bio.pairwise2 to identify the alignment sequence using pairwise method. Pairwise sequence alignment compares only two sequences at a time and provides best possible sequence alignments. Here, parse method returns iterable alignment object and it can be iterated to get actual alignments. > alignments = AlignIO.parse(open("PF18225_seed.txt"), "stockholm") If the input sequence alignment format contains more than one sequence alignment, then we need to use parse method instead of read method as specified below − In multiple sequence alignment concept, two or more sequences are compared for best subsequence matches between them and results in multiple sequence alignment in a single file. In general, most of the sequence alignment files contain single alignment data and it is enough to use read method to parse it. TRRHGPESFRFWLERQPVEARDRIYAIDRSGAEILDRPIPRGMAPLFKVLSFRNREDQGLVNNKPĪINRNTQQLTQDLRAMPNWSLRFVYIVDRNNQDLLKRPLPPGIMVLAPRLTAKHPYDKVQDRNRKĪVNATEREFTERIRTLPHWARRNVFVLDSQGFEIFDRELPSPVADLMRKLDLDRPFKKLERKNRT We can also check the sequences (SeqRecord) available in the alignment as well as below − TRRHGPESFRFWLERQPVEARDRIYAIDRSGAEILDRPIPRGMA.NKP A0A0X3UC67_9GAMM/57-121ĪINRNTQQLTQDLRAMPNWSLRFVYIVDRNNQDLLKRPLPPGIM.NRK B3PFT7_CELJU/62-126ĪVNATEREFTERIRTLPHWARRNVFVLDSQGFEIFDRELPSPVA.NRT K4KEM7_SIMAS/61-125 MQNTPAERLPAIIEKAKSKHDINVWLLDRQGRDLLEQRVPAKVA.EGP B7RZ31_9GAMM/59-123ĪKQRGIAGLEEWLHRLDHSEAIPIFLIDEAGKDLLEREVPADIT.KKP A0A0C3NPG9_9PROT/58-119ĪRRHGQEYFQQWLERQPKKVKEQVFAVDQFGRELLGRPLPEDMA.KKP A0A143H元7_9GAMM/57-121 SingleLetterAlphabet() alignment with 6 rows and 65 columns > alignment = AlignIO.read(open("PF18225_seed.txt"), "stockholm") parse method returns iterable alignment object similar to parse method in Bio.SeqIO module. If the given file contain many alignment, we can use parse method. ![]() read method is used to read single alignment data available in the given file. Let us try to read the downloaded sequence alignment file using Bio.AlignIO as below − Import Bio.AlignIO module Step 3 − Go to alignment section and download the sequence alignment file in Stockholm format (PF18225_seed.txt). Here, we have selected/clicked PF18225 and it opens go to and shows complete details about it, including sequence alignments. It contains minimal data and enables us to work easily with the alignment. Step 2 − Choose any one family having less number of seed value. It will show all the Pfam families in alphabetical order. ![]() Step 1 − Open your favorite browser and go to website. To download the sample file, follow the below steps − Bio.AlignIO provides API similar to Bio.SeqIO except that the Bio.SeqIO works on the sequence data and Bio.AlignIO works on the sequence alignment data.īefore starting to learn, let us download a sample sequence alignment file from the Internet. In bioinformatics, there are lot of formats available to specify the sequence alignment data similar to earlier learned sequence data. Let us learn some of the important features provided by Biopython in this chapter − Parsing Sequence Alignmentīiopython provides a module, Bio.AlignIO to read and write sequence alignments. Biopython provides extensive support for sequence alignment. Identifying the similar region enables us to infer a lot of information like what traits are conserved between species, how close different species genetically are, how species evolve, etc. Sequence alignment is the process of arranging two or more sequences (of DNA, RNA or protein sequences) in a specific order to identify the region of similarity between them. ![]() Foodie subscription box9/17/2023 ![]() ![]() Best Wine Subscription Box: Marchtown Wine Subscription.Best Cocktail Subscription Box: Taste Cocktails Cocktail Kit.Best Home Baking Subscription Box: Bakedin Baking Club.Best Japanese Subscription Box: Bokksu Snack Subscription Box.Best Tea Subscription Box: Blue Coffee Box.Best Cookery School Subscription: Smart School Of Cookery.The Best Green Subscription Box: Green Chef Box.Best Sweets Subscription Box: Sweet Kreations.Best Bread Baking Subscription Box: Honeywell Biscuit Co.Best Chocolate Subscription Box: Letter Box Hampers Chocoholics Set.Best Rum Subscription Box: Little Rum Box.Best Brownie Subscription Box: Brownie Club by the Shortbread Gift Company.Best Beer Subscription Box: Beer For a Year Membership.Best Kids Cooking Subscription Box: Little Bakers Box.Best UK Coffee Subscriptions: Coffee Factory Coffee Club & Batch Coffee. ![]() Best Sri Lankan Cooking Subscription Boxes: Little Big Flavour Kits.Best Italian Subscription Box: Pasta Evangelists.Best Cheese Subscription Boxes: Cheaze and Cows and Co.Best Gin Subscription Box: Little Gin Box.Best Spice Subscription Boxes: The Spicery.Not only has it taught me more about one of my favourite tipples, I’ve discovered a few new favourite bottles and enjoyed a lovely feeling of excitement when it arrives. There are stories to go with each bottle, as well as tasting notes and suggested pairings. At the start of each month, a perfectly-packaged little box arrives in the post, containing two 50ml bottles of rum. I was inspired by the present a friend of mine gave me for my last birthday: a 6-month rum subscription. There are lots of lovely ways to mark their special day with a gift in the post. But it’s taught us that there are still plenty of ways to celebrate your best friends even if you can’t see them in person. We’ve all struggled over the last few years with not being able to see friends and family for special occasions. From coffee beans and exotic spices, to bread recipes, cheese and craft beer, these are the best subscription boxes for foodies – perfect if you’re looking for a unique gift for a friend or family member. ![]() Wahoo fish taste like9/17/2023 ![]() ![]() We also use only 1 tablespoon of butter to sear the lean wahoo fish in a skillet. Do not move the fish during cooking, only flip once.Ībsolutely it is! The “blackening” comes from a combination of spices that are simple dried herbs with just a bit of salt. Add cobia and cook 3 minutes on each side. Make sure the skillet is very hot before adding fish. Cover wahoo blocks with the seasonings completely. I used garlic powder, thyme, pinch of cumin, black pepper, paprika and salt. Rinse fillets with cold running water and pat dry with paper towels. Leave fillets in the fridge overnight or just on the counter for couple hours. If you have frozen fish you will need to defrost it first. ![]() It helps to cut through the “fishiness” so all you taste is the lovely flavors of the fish and blackening seasoning. A generous squeeze of fresh lemon to finish the dish adds acid to the blackened wahoo. Deeply savory and umami, garlic brings every flavor together in one big happy spice family. Either of these dried herbs adds a bright but earthy and comforting taste to the blend. Rather mellow, earthy spice that pairs perfectly with bold black pepper and paprika. Freshly ground gives the biggest punch of delicious spiciness.Ĭumin. Smoky and deep, it instantly gives dishes a slightly grilled/smoked taste.īlack pepper. Essential cooking spice to emphasize all other flavors. Unsalted butter is best to keep the sodium content minimal but without lacking any flavor. Because this is a very large fish, wahoo is sold in thick cuts called “blocks” rather than as whole fillets.īutter. It’s great to serve as a healthy and simple dinner with some serious pizazz! Recipe ingredients So every bite has the perfect balance of heat!īest of all, the dish is ready to serve in only about 15 minutes from start to finish. It’s slightly crisp with layers of peppery, earthy, and smoky flavors wrapped around flaky, tender, and mild white fish. This creates a spicy “blackened” crust that is irresistible… We use this spice combo to coat thick pieces of tender wahoo saku, then sear them with butter in a hot skillet. The iconic blackening seasoning is a simple but powerful blend of common kitchen spices, like black pepper and cumin. This blackened wahoo recipe is a wonderful example! In fact with just a handful of key ingredients and a skillet you can make a restaurant-quality dish in a snap. ![]() If you’ve been on this site for more than a minute or two you already know that busy weeknight meals do not – and should not! – have to be boring. If you like air fried fish or seafood in general, you will love my air fryer haddockrecipe. It’s perfect for an exciting meal any night of the week! Blackened wahoo is a bold and delicious seafood dish that has just the right kick of heat! But while the flaky and tender fish is crusted with vibrant flavors, this recipe is easy to make on the stovetop in less than 15 minutes. ![]() Panda antivirus free trial 90 days9/16/2023 ![]() ![]() You can back up to a disk drive or CD/DVD or removable drive. ![]() The backup module will provide local and cloud backup of your files. The Firewall module, when enabled protects your PC from networks threats and parental controls enable you to choose a filter for each windows account and this can be none, kids, teen, employee or custom settings. Norton AntiVirus Basic previously had a free trial offer, however, we now offer Norton AntiVirus Plus. Our free trial offers full access to complete protection like Antivirus, Ransomware Protection, Secure VPN, Password Manager, Identity Theft Protection and more. The Process monitor module provides a live view of network activity, it shows which sites and ports are being accessed by what programs. Free Antivirus Norton 360 Offers Complete Protection - 14 Days Free Trial. Clicking on the ‘Rescue kit’ module, you will find an option to create a USB rescue drive and this can turn a USB flash drive into a bootable device that can disinfect a PC that won’t start because of malware. On the home screen, clicking the ‘ Scan’ module will display 3 options : quick(critical areas), full and custom scans. The suite has a user-friendly interface, every major aspect of the suite will be available by clicking on the relevant module. The installation of this security suite is quick and straightforward, however, look out to ‘uncheck’ boxes such as browser toolbar to avoid unnecessary modifications to your browser. Depending on your system OS download the setup file, install the software and sign in to your Panda security account. ![]() You will Notice Panda Dome Complete 180 days subscription is added to your account.Ĭlick the product to view download links for setup files or installer for your OS ( Windows, Mac, Android & iOS). Next visit, create an account and after activating your account, click “I have Code” and enter the code you received. The giveaway page will display license code, copy the code and don’t download SOS installer. Simply visit the giveaway page and click Download, go ahead start filling the form by entering your email address ( avoid spam using 10-minute Mail service), and other details, finally hit “Give it to me” button. SOS webpage is now offering free 6-month License code (3PC) worth $47.9 for next 13 days. In addition to protecting your PC, it will also protect your iOS devices, Apple Macs, Android phones and tablets. The PC Cleanup or tune Up function helps to keep your system in tip-top order, and the security software also includes Process Monitor, Application Control, an Anti-Theft module for locating lost or stolen computer and disinfection tools such as USB vaccine, Rescue kit. There’s also a parental control mechanism, online backup, password management, military level AES 256-bit file encryption and a secure file shredder. Panda Dome Completeaka Panda Global Protection 2018 includes all manner of security elements such as antivirus, firewall, wi-fi protection and a data shield. Panda Dome Complete is the top-of-the-range security product from Panda Security that includes Panda Dome Essential, Panda Dome Advanced, Panda Dome Complete aka Gold Protection and PANDA DOME Premium. ![]() Price for tabby point siamese9/16/2023 ![]() ![]() When these Siamese felines are mated, their offspring will have a slim appearance. The contemporary Siamese’s parents are one of each: a traditional and a classic Siamese. ![]() Cats have longer bodies and less rounded heads. The second type to originate directly from Thailand is the classic Siamese cat, which has a somewhat distinct look. These animals have huge bones and round heads. ![]() These cats have arrived straight from Thailand, or they are the offspring of traditional Siamese cats. An inexperienced eye may be unable to distinguish between these types of Siamese cats. The look of different Siamese cat varieties varies. After the first month of life, the specific Siamese points start to occur. Respectively, the pictures of Siamese cats that live in colder climates prove that these felines are characterized by darkened body fur and points.īesides, each Siamese kitty is born with white or beige coat color. The ear tips, face, paws, and tail of the Siamese cats are usually darker than the rest of their body because they are cooler and, thus, feature darker fur.ĭue to this peculiarity related to the temperature, the Siamese cats that live in warmer climate zones commonly have lighter cat colors and patterns of their points. The key characteristic of this enzyme is that it doesn’t work at normal body temperature so it doesn’t produce melanin and that’s why the felines of the Siamese cat breeds have white or creamy fur.īut we couldn’t say the same about the extremities of the Siamese breeds. The pointed purebred Siamese markings are considered as a particular type of albinism that occurs because of an enzyme that emits melanin (which is responsible for a cat’s coat color. ![]() Actually, it isn’t a difficult question to answer because the Siamese cat markings that are so distinct and at the same time appealing can appear due to the phenomenon called the “Himalayan gene”. This is a matter that is of concern to many cat fans. I don't see my cats' ghost markings any more clearly when I shine a black light on them.The Siamese cat is a uniquely beautiful creature with a specific appearance that can make its master’s life more exciting and thrilling. Bright sunlight can make ghost markings more visible, but I'm not sure what you mean about UV light. Ghost markings on solid cats usually fade in adulthood, but may remain somewhat visible, especially on the tail, or in seasons of the year when the undercoat sheds out. However, some solid colored kittens have very "clear" coats that don't show the ghost markings, while other solid cats have a genetically determined ticked tabby pattern, so you won't see ghost stripes or spots. Solid cats usually, but not always, have some ghost markings as kittens that display the tabby pattern the cat would have had, if it were a tabby. Solid colored cats (black, blue, chocolate, cinnamon, etc.) are homozygous for the non-agouti gene which suppresses the tabby pattern. In hybrid breeds such as the Bengal, additional tabby patterns exist (rosetted, marbled). Tabby patterns in the domestic cat include mackerel, classic (blotched), spotted, ticked, and some intermediate variations between these patterns (such as broken mackerel). The tabby pattern may or may not be expressed, depending on other genes. All cats do have a genetically determined tabby pattern. ![]() Napoleon total war money cheat9/16/2023 ![]() With ships under his command, Napoleon can send them out to leech off a nearby Sardinian trade route and blockade the port of Olbia. ![]() Under the direction of his mentor, Baron du Teil, Napoleon will convert the commercial port of Genoa into a shipyard. Things really heat up when Sardinia declares war on France. The new campaigns let you follow in Napoleon's footsteps. Once things have settled down, you can repair the buildings that have been damaged by the strikers. You'll be encouraged to restore peace by adjusting the tax, building opera houses, or simply increasing dragoon garrisons. While you're busy building cannon foundries and upgrade gun smithies in Paris and Dijon, workers will go on strike to protest high taxes. The real fun begins when Napoleon moves to study at Paris' Ecole Militaire and begins to seek his fortune during the Revolution. You'll learn about naval transport by moving Napoleon from Corsica to southern France, you'll study the intricacies of diplomacy by negotiating a trade agreement with the Swiss and you'll discover the joys of infrastructure management by building colleges, roads and researching technology near Reims. It builds a player's knowledge of the interface and mechanics by following the story of Napoleon's early years. The tutorial campaign tells the story of Napoleon's rise to power, from unknown Corsican student to the hero of the Revolution. ![]() Our build includes two of the campaigns that will ship with the retail version of the game. ![]() Who owns home title lock9/16/2023 ![]() ![]() Read on to learn how home title theft happens, what you can do to prevent it and what steps you can take if it has already occurred. The FBI’s 2021 Internet Crime Report found that in that year alone, over $350 million was lost to real estate–related online criminals. Online crime preying on real estate is growing, and it can have devastating consequences. It typically targets properties with significant equity, which puts often-empty vacation homes and long-owned houses belonging to senior citizens at particularly high risk. Scary, right? Home title theft is a crime, considered a subtype of identity theft. Imagine a stranger attempting to steal your home out from under you by transferring the title without your knowledge or consent. While we strive to provide a wide range offers, Bankrate does not include information about every financial or credit product or service. Other factors, such as our own proprietary website rules and whether a product is offered in your area or at your self-selected credit score range can also impact how and where products appear on this site. Therefore, this compensation may impact how, where and in what order products appear within listing categories, except where prohibited by law for our mortgage, home equity and other home lending products. We are compensated in exchange for placement of sponsored products and, services, or by you clicking on certain links posted on our site. We’re transparent about how we are able to bring quality content, competitive rates, and useful tools to you by explaining how we make money.ī is an independent, advertising-supported publisher and comparison service. The content created by our editorial staff is objective, factual, and not influenced by our advertisers. Our award-winning editors and reporters create honest and accurate content to help you make the right financial decisions. We continually strive to provide consumers with the expert advice and tools needed to succeed throughout life’s financial journey.Įditorial policy, so you can trust that our content is honest and accurate. Our experts have been helping you master your money for over four decades. So, whether you’re reading an article or a review, you can trust that you’re getting credible and dependable information. Our editorial team receives no direct compensation from advertisers, and our content is thoroughly fact-checked to ensure accuracy. We follow strict guidelines to ensure that our editorial content is not influenced by advertisers. Our goal is to give you the best advice to help you make smart personal finance decisions. Our editorial team does not receive direct compensation from our advertisers.īankrate’s editorial team writes on behalf of YOU – the reader. We maintain a firewall between our advertisers and our editorial team. ![]() Our editors and reporters thoroughly fact-check editorial content to ensure the information you’re reading is accurate. Our mission is to provide readers with accurate and unbiased information, and we have editorial standards in place to ensure that happens. ![]() We do not include the universe of companies or financial offers that may be available to you.īankrate follows a strict editorial policy, so you can trust that we’re putting your interests first. But this compensation does not influence the information we publish, or the reviews that you see on this site. This compensation may impact how and where products appear on this site, including, for example, the order in which they may appear within the listing categories, except where prohibited by law for our mortgage, home equity and other home lending products. The offers that appear on this site are from companies that compensate us. Our goal is to help you make smarter financial decisions by providing you with interactive tools and financial calculators, publishing original and objective content, by enabling you to conduct research and compare information for free - so that you can make financial decisions with confidence.īankrate has partnerships with issuers including, but not limited to, American Express, Bank of America, Capital One, Chase, Citi and Discover. We are an independent, advertising-supported comparison service. ![]() Vankyo projector9/16/2023 ![]() Whether this is really important to you depends on how clear of an image you’d like. This means you’ll see finer textures and skin pores in a movie or video game, versus a lower 480p projector, which will be blurrier. The higher the native resolution, the crisper and clearer your image will appear. This spec is the actual internal resolution that the projector is capable of projecting onto your wall. The important information that you need to know is the “native resolution”. This is a term that is thrown around a lot and is used in ways that the average consumer may not realize. Vankyo V630 Offers (NEW Alternative Choice).Let’s review the resolution and jump into everything right away. Do you need a certain type of connectivity? What about the specifications and their meanings? I’ll try to go over as many things as possible to point out all of these things to help you make the right buying decision. You undoubtedly want to get a projector that’s right for you, one that has the features that you need. I’m going to go ahead and assume that you’re looking for answers to some questions. Perhaps you’d assume that the higher the number, the better it is, but the V620 for instance comes equipped with a “Component” input, which the others don’t have. They actually do have differences that may not seem apparent at first glance. This model is now the fourth version that exists, which may make the consumer a bit confused as to which one is the best. The Vankyo Performance V630 is an updated version of the popular V6XX series projectors. ![]() AuthorWrite something about yourself. No need to be fancy, just an overview. ArchivesCategories |